- FAM70B Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-81175
- 0.1 ml
- Unconjugated
- FAM70B
- FAM70B
- PBS (pH 7.2) and 40% Glycerol
- Rabbit
- Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin
- Human
- This antibody was developed against Recombinant Protein corresponding to amino acids: VPLSQLAYGP AVPPQTLYNP AQQILAYAGF RLTPEPVPTC SSYPLPLQPC SRFPVAPSSA LASSEDLQPP SPSSSGSGLP GQAPPCYAP
- transmembrane protein 255B
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
VPLSQLAYGPAVPPQTLYNPAQQILAYAGFRLTPEPVPTCSSYPLPLQPCSRFPVAPSSALASSEDLQPPSPSSSGSGLPGQAPPCYAP
Specifications/Features
Available conjugates: Unconjugated